PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G115200.1.p
Common NameSb06g019650, SORBIDRAFT_06g019650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 372aa    MW: 39450.2 Da    PI: 5.8059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G115200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Sobic.006G115200.1.p 14 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                          89********************************************97 PP

2Myb_DNA-binding45.12.3e-1468110246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.006G115200.1.p  68 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                           789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.716965IPR017930Myb domain
SuperFamilySSF466899.56E-3012108IPR009057Homeodomain-like
SMARTSM007173.8E-141363IPR001005SANT/Myb domain
PfamPF002496.4E-171461IPR001005SANT/Myb domain
CDDcd001677.10E-131761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465116IPR009057Homeodomain-like
SMARTSM007172.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.19766116IPR017930Myb domain
PfamPF002496.8E-1368110IPR001005SANT/Myb domain
CDDcd001671.36E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRIPCCEKD SVKRGQWTPE EDNKLLSYIT QYGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF TDAEEQTIIK LHSVVGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKSFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRPT DFPSPAVPPD  180
MATIAGGSGA GALGAPPCGF PAPPQTDDTI ERIKLGLSRA IMSEPGAPPG KQQQPPWAPA  240
DVTEGLAGMY ATYNPATHAQ EEFRYDNGAV PEYVLGGAGA GGDADQGTSM WSHQSMYSGS  300
SGTEAAPRPM AALPEKGNDS VGSSGGGGGG GGDEEADDVK DGGKGGSDMS GLFGSDCVLW  360
DLPDELTNHM V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342380.0BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds.
GenBankBT0394220.0BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds.
GenBankBT0406700.0BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds.
GenBankBT0432400.0BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds.
GenBankBT0549880.0BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448013.10.0hypothetical protein SORBIDRAFT_06g019650
SwissprotQ7XQN10.0MYB80_ORYSJ; Transcription factor MYB80
TrEMBLC5YAB30.0C5YAB3_SORBI; Putative uncharacterized protein Sb06g019650
STRINGSb06g019650.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-112myb domain protein 103